PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00063g11003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 493aa    MW: 53803.1 Da    PI: 6.7677
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00063g11003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.5e-39148208262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s 
  Niben101Scf00063g11003.1 148 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNSA 208
                               7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30145205IPR003851Zinc finger, Dof-type
PfamPF027013.0E-32150206IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.919152206IPR003851Zinc finger, Dof-type
PROSITE patternPS013610154190IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MRQVKDPEIK LFGKKIALPE NGKTLTVIIS GEDSVVVKPS GAKESSSGWN RDPCLVDMEA  60
SSPDESDDGS EYENEKADKD QVRRELAEDT SEEKDQDQVM KESENPKSPS ESENKPKTPP  120
LGDESPTVKT SKTENDATDS QQKTLKKPDK ILPCPRCNSM DTKFCYYNNY NVNQPRHFCK  180
SCQRYWTAGG TMRNVPVGAG RRKNKNSASH CHHIMISEAL QAARIDPPNG FHHPMLKPNG  240
TVLSFGPDSP LCDSMASVMN LPEKKTPNGI RNGYYKQEHK NPSCIGGENV DDCSSGSSVT  300
TNSMTEGGKN RPPEALMQNM NGFPSPVPCL PGVPWPFPYA AVPFPAMNPA AFPMPFCPPP  360
YWNCNVPGPW SIPWLAPPSS TANQNGSGSS PSSPLGKHSR DGDLLRPNNP EGQKNSEGSV  420
LVPKTLRIDD PDEAAKSSIW STLGINYDSV SRGGLFKGFQ PKSSEKDHPA TTSPVLQANP  480
VAFSRSLIFQ ERA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619973.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLM1BQ210.0M1BQ21_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000502730.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-95cycling DOF factor 3